Lineage for d1sc7a2 (1sc7 A:431-633,A:714-765)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225506Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1225507Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1225596Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 1225597Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 1225598Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1225606Domain d1sc7a2: 1sc7 A:431-633,A:714-765 [118945]
    Other proteins in same PDB: d1sc7a1, d1sc7a3
    automatically matched to d1ej9a1
    protein/DNA complex; complexed with m38, pg4

Details for d1sc7a2

PDB Entry: 1sc7 (more details), 3 Å

PDB Description: Human DNA Topoisomerase I (70 Kda) In Complex With The Indenoisoquinoline MJ-II-38 and Covalent Complex With A 22 Base Pair DNA Duplex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1sc7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc7a2 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnyldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

SCOPe Domain Coordinates for d1sc7a2:

Click to download the PDB-style file with coordinates for d1sc7a2.
(The format of our PDB-style files is described here.)

Timeline for d1sc7a2: