Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId:8717] [143953] (1 PDB entry) Uniprot P81397 1-132 |
Domain d1sb2a1: 1sb2 A:1-132 [118927] Other proteins in same PDB: d1sb2b1 |
PDB Entry: 1sb2 (more details), 1.9 Å
SCOPe Domain Sequences for d1sb2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} dcpdgwsstksycyrpfkekktweeaerfcteqekeahlvsmenrleavfvdmvmennfe nkiyrswiglkienkgqrsnlewsdgssisyenlyepymekcflmdhqsglpkwhtadce eknvfmckfqlp
Timeline for d1sb2a1: