PDB entry 1sb2

View 1sb2 on RCSB PDB site
Description: High resolution Structure determination of rhodocetin
Class: toxin
Keywords: C-type lectin; domain swapping, TOXIN
Deposited on 2004-02-10, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhodocetin alpha subunit
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sb2a1
  • Chain 'B':
    Compound: Rhodocetin beta subunit
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sb2b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sb2A (A:)
    dcpdgwsstksycyrpfkekktweeaerfcteqekeahlvsmenrleavfvdmvmennfe
    nkiyrswiglkienkgqrsnlewsdgssisyenlyepymekcflmdhqsglpkwhtadce
    eknvfmckfqlpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb2A (A:)
    dcpdgwsstksycyrpfkekktweeaerfcteqekeahlvsmenrleavfvdmvmennfe
    nkiyrswiglkienkgqrsnlewsdgssisyenlyepymekcflmdhqsglpkwhtadce
    eknvfmckfqlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sb2B (B:)
    dfrcpttwsasklycykpfkekktwieaerfcakqaenghlvsigsaaeadfldlvivvn
    fdkqryrawtglternlkwtngasvsyenlyepyirkcfvvqpwegkskwykadceekna
    flckfpkph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sb2B (B:)
    frcpttwsasklycykpfkekktwieaerfcakqaenghlvsigsaaeadfldlvivvnf
    ryrawtglternlkwtngasvsyenlyepyirkcfvvqpwegkskwykadceeknaflck
    fpkp