SCOP 1.73: Domain d1s9cg1: 1s9c G:164-289

Lineage for d1s9cg1 (1s9c G:164-289)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
   duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry)
   the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ

8. Domain d1s9cg1: 1s9c G:164-289 [118901]
   automatically matched to 1S9C A:164-289
   mutant

Details for d1s9cg1

PDB Entry: 1s9c, 3 Å

PDB Description: crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2

PDB Compounds: (G:) Peroxisomal multifunctional enzyme type 2

SCOP Domain Sequences for d1s9cg1:

Sequence; same for both SEQRES and ATOM records:

>d1s9cg1 d.38.1.4 (G:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}
avaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfs
arrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisn
ayvdla

Timeline for d1s9cg1:

• d1s9cg1 is new in SCOP 1.73
  
• d1s9cg1 appears in SCOP 1.75
  
• d1s9cg1 appears in the current release, SCOPe 2.08