Lineage for d1s7nb_ (1s7n B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1215354Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1215355Protein automated matches [190038] (10 species)
    not a true protein
  7. 1215371Species Salmonella typhimurium [TaxId:99287] [186758] (4 PDB entries)
  8. 1215374Domain d1s7nb_: 1s7n B: [118881]
    automated match to d1nsla_
    complexed with coa

Details for d1s7nb_

PDB Entry: 1s7n (more details), 2.1 Å

PDB Description: ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)
PDB Compounds: (B:) acetyl transferase

SCOPe Domain Sequences for d1s7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7nb_ d.108.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
mveiipvsttlelraadeshvpalhqlvlknkawlqqsldwpqyvtsqeetrkhvqgnil
lhqrgyakmylifcqnemagvlsfnaiepinkaayigywldesfqgqgimsqslqalmth
yarrgdirrfvikcrvdnqasnavarrnhftlegcmkqaeylngdyhdvnmyariidad

SCOPe Domain Coordinates for d1s7nb_:

Click to download the PDB-style file with coordinates for d1s7nb_.
(The format of our PDB-style files is described here.)

Timeline for d1s7nb_: