Lineage for d1ryic1 (1ryi C:1-218,C:307-364)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849427Protein Glycine oxidase ThiO [89544] (1 species)
  7. 2849428Species Bacillus sp. [TaxId:1409] [89545] (3 PDB entries)
  8. 2849431Domain d1ryic1: 1ryi C:1-218,C:307-364 [118817]
    Other proteins in same PDB: d1ryia2, d1ryib2, d1ryic2, d1ryid2
    automatically matched to d1ng3a1
    complexed with fad, goa

Details for d1ryic1

PDB Entry: 1ryi (more details), 1.8 Å

PDB Description: structure of glycine oxidase with bound inhibitor glycolate
PDB Compounds: (C:) glycine oxidase

SCOPe Domain Sequences for d1ryic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryic1 c.3.1.2 (C:1-218,C:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk

SCOPe Domain Coordinates for d1ryic1:

Click to download the PDB-style file with coordinates for d1ryic1.
(The format of our PDB-style files is described here.)

Timeline for d1ryic1: