| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
| Protein Glycine oxidase ThiO [89544] (1 species) |
| Species Bacillus sp. [TaxId:1409] [89545] (3 PDB entries) |
| Domain d1ryic1: 1ryi C:1-218,C:307-364 [118817] Other proteins in same PDB: d1ryia2, d1ryib2, d1ryic2, d1ryid2 automatically matched to d1ng3a1 complexed with fad, goa |
PDB Entry: 1ryi (more details), 1.8 Å
SCOPe Domain Sequences for d1ryic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryic1 c.3.1.2 (C:1-218,C:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk
Timeline for d1ryic1: