![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
![]() | Protein Glycine oxidase ThiO [89843] (1 species) |
![]() | Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries) |
![]() | Domain d1ryib2: 1ryi B:219-306 [118816] Other proteins in same PDB: d1ryia1, d1ryib1, d1ryic1, d1ryid1 automatically matched to d1ng3a2 complexed with fad, goa |
PDB Entry: 1ryi (more details), 1.8 Å
SCOPe Domain Sequences for d1ryib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryib2 d.16.1.3 (B:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv mkkaktmlpaiqnmkvdrfwaglrpgtk
Timeline for d1ryib2: