Lineage for d1rxtd1 (1rxt D:85-218)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664677Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 1664678Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 1664688Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry)
    Uniprot P30419 155-294! Uniprot P30419 295-496
  8. 1664695Domain d1rxtd1: 1rxt D:85-218 [118799]

Details for d1rxtd1

PDB Entry: 1rxt (more details), 3 Å

PDB Description: Crystal structure of human myristoyl-CoA:protein N-myristoyltransferase.
PDB Compounds: (D:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d1rxtd1:

Sequence, based on SEQRES records: (download)

>d1rxtd1 d.108.1.2 (D:85-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
dlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrk
lvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavy
tagvvlpkpvgtcr

Sequence, based on observed residues (ATOM records): (download)

>d1rxtd1 d.108.1.2 (D:85-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
dlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvgfisaip
anihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkp
vgtcr

SCOPe Domain Coordinates for d1rxtd1:

Click to download the PDB-style file with coordinates for d1rxtd1.
(The format of our PDB-style files is described here.)

Timeline for d1rxtd1: