Lineage for d1pk3a1 (1pk3 A:6-79)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493442Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1493475Protein Polycomb protein Scm [140620] (1 species)
  7. 1493476Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries)
    Uniprot Q9VHA0 795-871
  8. 1493477Domain d1pk3a1: 1pk3 A:6-79 [118715]
    Other proteins in same PDB: d1pk3b_, d1pk3c_
    complexed with bme

Details for d1pk3a1

PDB Entry: 1pk3 (more details), 1.85 Å

PDB Description: scm sam domain
PDB Compounds: (A:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk3a1 a.60.1.2 (A:6-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
anshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglk
lgpalkicnlvnkv

SCOPe Domain Coordinates for d1pk3a1:

Click to download the PDB-style file with coordinates for d1pk3a1.
(The format of our PDB-style files is described here.)

Timeline for d1pk3a1: