| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein Polycomb protein Scm [140620] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries) Uniprot Q9VHA0 795-871 |
| Domain d1pk1b1: 1pk1 B:17-79 [118712] Other proteins in same PDB: d1pk1a1, d1pk1c_, d1pk1d_ |
PDB Entry: 1pk1 (more details), 1.8 Å
SCOPe Domain Sequences for d1pk1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk1b1 a.60.1.2 (B:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
wtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkicnlv
nkv
Timeline for d1pk1b1: