Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Thermus aquaticus [TaxId:271] [254880] (1 PDB entry) |
Domain d1ob5e3: 1ob5 E:6-212 [118699] Other proteins in same PDB: d1ob5a1, d1ob5a2, d1ob5c1, d1ob5c2, d1ob5e1, d1ob5e2 automated match to d1b23p3 protein/RNA complex; complexed with enx, gnp, mg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOPe Domain Sequences for d1ob5e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5e3 c.37.1.8 (E:6-212) automated matches {Thermus aquaticus [TaxId: 271]} irtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitint ahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarq vgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhkn pktkrgenewvdkiwelldaideyipt
Timeline for d1ob5e3: