| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (11 species) not a true protein |
| Domain d1ob5a2: 1ob5 A:313-405 [118692] Other proteins in same PDB: d1ob5a1, d1ob5a3, d1ob5c1, d1ob5c3, d1ob5e1, d1ob5e3 automated match to d1b23p2 protein/RNA complex; complexed with enx, gnp, mg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOPe Domain Sequences for d1ob5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5a2 b.44.1.0 (A:313-405) automated matches {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1ob5a2: