![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries) |
![]() | Domain d3sodg_: 3sod G: [118680] complexed with cu, zn; mutant |
PDB Entry: 3sod (more details), 2.1 Å
SCOPe Domain Sequences for d3sodg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sodg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]} atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek pddlgrggneestktgnagsrlacgvigiak
Timeline for d3sodg_: