PDB entry 3sod

View 3sod on RCSB PDB site
Description: changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase (superoxide acceptor)
Deposited on 1990-06-26, released 1993-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00442 (0-150)
      • conflict (5)
    Domains in SCOPe 2.06: d3sodb_
  • Chain 'G':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00442 (0-150)
      • conflict (5)
    Domains in SCOPe 2.06: d3sodg_
  • Chain 'O':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00442 (0-150)
      • conflict (5)
    Domains in SCOPe 2.06: d3sodo_
  • Chain 'Y':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00442 (0-150)
      • conflict (5)
    Domains in SCOPe 2.06: d3sody_
  • Heterogens: CU, ZN

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sodB (B:)
    atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sodG (G:)
    atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sodO (O:)
    atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sodY (Y:)
    atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak