![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Trypanothione reductase [51947] (2 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [51949] (4 PDB entries) |
![]() | Domain d1ndad1: 1nda D:170-286 [118567] Other proteins in same PDB: d1ndaa3, d1ndab3, d1ndac3, d1ndad3 duplicate of 1NDA A:170-286 complexed with fad |
PDB Entry: 1nda (more details), 3.3 Å
SCOPe Domain Sequences for d1ndad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndad1 c.3.1.5 (D:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} pgiehcissneafylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrg fdhtlreeltkqltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaig
Timeline for d1ndad1: