Lineage for d1hcyf1 (1hcy F:1-135)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919128Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 919129Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 919130Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 919131Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 919137Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (2 PDB entries)
  8. 919144Domain d1hcyf1: 1hcy F:1-135 [118499]
    Other proteins in same PDB: d1hcya2, d1hcya3, d1hcyb2, d1hcyb3, d1hcyc2, d1hcyc3, d1hcyd2, d1hcyd3, d1hcye2, d1hcye3, d1hcyf2, d1hcyf3
    duplicate of 1HCY 1-135
    complexed with cu

Details for d1hcyf1

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (F:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hcyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcyf1 a.85.1.1 (F:1-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
vsvihsklgdgivlp

SCOPe Domain Coordinates for d1hcyf1:

Click to download the PDB-style file with coordinates for d1hcyf1.
(The format of our PDB-style files is described here.)

Timeline for d1hcyf1: