Lineage for d2bf9a_ (2bf9 A:)

  1. Root: SCOPe 2.01
  2. 1072259Class j: Peptides [58231] (120 folds)
  3. 1072474Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1072475Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1072476Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1072547Protein Pancreatic polypeptide [58286] (2 species)
  7. 1072552Species Turkey (Meleagris gallopavo) [TaxId:9103] [58288] (2 PDB entries)
    Uniprot P68249
  8. 1072553Domain d2bf9a_: 2bf9 A: [116717]
    complexed with zn

Details for d2bf9a_

PDB Entry: 2bf9 (more details), 0.99 Å

PDB Description: anisotropic refinement of avian (turkey) pancreatic polypeptide at 0. 99 angstroms resolution.
PDB Compounds: (A:) pancreatic hormone

SCOPe Domain Sequences for d2bf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bf9a_ j.6.1.1 (A:) Pancreatic polypeptide {Turkey (Meleagris gallopavo) [TaxId: 9103]}
gpsqptypgddapvedlirfyndlqqylnvvtrhrx

SCOPe Domain Coordinates for d2bf9a_:

Click to download the PDB-style file with coordinates for d2bf9a_.
(The format of our PDB-style files is described here.)

Timeline for d2bf9a_: