Lineage for d1yeyb1 (1yey B:184-432)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1148962Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1149027Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 1149197Protein RTS beta protein [117386] (1 species)
  7. 1149198Species Xanthomonas campestris pv. campestris [TaxId:340] [117387] (1 PDB entry)
    Uniprot Q8P3K2; extended, mainly helical linker between the domains
  8. 1149200Domain d1yeyb1: 1yey B:184-432 [116666]
    Other proteins in same PDB: d1yeya2, d1yeyb2, d1yeyc2, d1yeyd2
    Structural genomics target
    complexed with mg

Details for d1yeyb1

PDB Entry: 1yey (more details), 2.34 Å

PDB Description: crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. campestris str. atcc 33913
PDB Compounds: (B:) L-fuconate dehydratase

SCOPe Domain Sequences for d1yeyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yeyb1 c.1.11.2 (B:184-432) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]}
gypayttspgwlgysdeklvrlakeavadgfrtiklkvganvqddirrcrlaraaigpdi
amavdanqrwdvgpaidwmrqlaefdiawieeptspddvlghaairqgitpvpvstgeht
qnrvvfkqllqagavdliqidaarvggvnenlailllaakfgvrvfphaggvglcelvqh
lamadfvaitgkmedraiefvdhlhqhfldpvriqhgrylapevpgfsaemhpasiaefs
ypdgrfwve

SCOPe Domain Coordinates for d1yeyb1:

Click to download the PDB-style file with coordinates for d1yeyb1.
(The format of our PDB-style files is described here.)

Timeline for d1yeyb1: