Lineage for d1ydgb_ (1ydg B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587741Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 1587750Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. 1587751Species Deinococcus radiodurans [TaxId:1299] [117476] (2 PDB entries)
    Uniprot Q9RYU4
  8. 1587753Domain d1ydgb_: 1ydg B: [116615]
    Structural genomics target
    complexed with so4

Details for d1ydgb_

PDB Entry: 1ydg (more details), 2 Å

PDB Description: crystal structure of trp repressor binding protein wrba
PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1ydgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydgb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]}
tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
asirhqvrrqveltaklleggs

SCOPe Domain Coordinates for d1ydgb_:

Click to download the PDB-style file with coordinates for d1ydgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ydgb_: