Lineage for d1y7he_ (1y7h E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901127Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2901180Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)
  7. 2901181Species Tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
    Uniprot Q6RYA0
  8. 2901192Domain d1y7he_: 1y7h E: [116542]
    Structural genomics target
    complexed with scn

Details for d1y7he_

PDB Entry: 1y7h (more details), 2.52 Å

PDB Description: structural and biochemical studies identify tobacco sabp2 as a methylsalicylate esterase and further implicate it in plant innate immunity, northeast structural genomics target ar2241
PDB Compounds: (E:) salicylic acid-binding protein 2

SCOPe Domain Sequences for d1y7he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7he_ c.69.1.20 (E:) Salicylic acid-binding protein 2 (SABP2) {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
lcepqklcaslleiahky

SCOPe Domain Coordinates for d1y7he_:

Click to download the PDB-style file with coordinates for d1y7he_.
(The format of our PDB-style files is described here.)

Timeline for d1y7he_: