PDB entry 1y7h

View 1y7h on RCSB PDB site
Description: Structural and biochemical studies identify tobacco SABP2 as a methylsalicylate esterase and further implicate it in plant innate immunity, Northeast Structural Genomics Target AR2241
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, Protein Structure Initiative, PSI, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-12-08, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7ha_
  • Chain 'B':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hb_
  • Chain 'C':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hc_
  • Chain 'D':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hd_
  • Chain 'E':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7he_
  • Chain 'F':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hf_
  • Chain 'G':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hg_
  • Chain 'H':
    Compound: salicylic acid-binding protein 2
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYA0 (Start-259)
      • modified residue (62)
      • modified residue (65)
      • modified residue (84)
      • modified residue (90)
      • modified residue (107)
      • modified residue (148)
      • modified residue (182)
      • modified residue (238)
      • modified residue (240)
    Domains in SCOPe 2.08: d1y7hh_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y7hA (A:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hA (A:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y7hB (B:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hB (B:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahkyn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y7hC (C:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hC (C:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y7hD (D:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hD (D:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahkyn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y7hE (E:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hE (E:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahky
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y7hF (F:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hF (F:)
    egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
    melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
    nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
    medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
    cepqklcaslleiahkyn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1y7hG (G:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hG (G:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1y7hH (H:)
    mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytl
    plmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvle
    qynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpss
    lfmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhma
    mlcepqklcaslleiahkynlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y7hH (H:)
    kegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlp
    lmelmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleq
    ynertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpssl
    fmedlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmam
    lcepqklcaslleiahkyn