![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
![]() | Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) ![]() some topological similarity to osmotin |
![]() | Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins) Pfam PF07367 |
![]() | Protein TF antigen-binding lectin [117122] (1 species) |
![]() | Species Common mushroom (Agaricus bisporus) [TaxId:5341] [117123] (5 PDB entries) Uniprot Q00022 |
![]() | Domain d1y2xd_: 1y2x D: [116418] complexed with nag, ser |
PDB Entry: 1y2x (more details), 2.36 Å
SCOPe Domain Sequences for d1y2xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2xd_ b.97.1.2 (D:) TF antigen-binding lectin {Common mushroom (Agaricus bisporus) [TaxId: 5341]} tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg rrfaieytvtegdnlkanliig
Timeline for d1y2xd_: