PDB entry 1y2x

View 1y2x on RCSB PDB site
Description: Crystal structure of the tetragonal form of the common edible mushroom (Agaricus bisporus) lectin in complex with T-antigen and N-acetylglucosamine
Class: sugar binding protein
Keywords: ABL, Agaricus bisporus, lectin, mushroom, T-antigen, SUGAR BINDING PROTEIN
Deposited on 2004-11-23, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.07: d1y2xa_
  • Chain 'B':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.07: d1y2xb_
  • Chain 'C':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.07: d1y2xc_
  • Chain 'D':
    Compound: lectin
    Species: Agaricus bisporus [TaxId:5341]
    Database cross-references and differences (RAF-indexed):
    • GB AAA85813 (0-131)
      • see remark 999 (62)
      • see remark 999 (132-141)
    Domains in SCOPe 2.07: d1y2xd_
  • Heterogens: NAG, SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xA (A:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xB (B:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xC (C:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y2xD (D:)
    tytisirvyqttpkgffrpvertnwkyanggtwdevrgeyvltmggsgtsgslrfvssdt
    desfvatfgvhnykrwcdivtnltneqtalvinqeyygvpirdqarenqltsynvanakg
    rrfaieytvtegdnlkanliig