Lineage for d1y23e_ (1y23 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929782Protein Hit [117789] (1 species)
  7. 2929783Species Bacillus subtilis [TaxId:1423] [117790] (1 PDB entry)
    Uniprot O07513
  8. 2929788Domain d1y23e_: 1y23 E: [116398]
    Structural genomics target
    complexed with mg, zn

Details for d1y23e_

PDB Entry: 1y23 (more details), 2.3 Å

PDB Description: crystal structure of a member of hit family of proteins from bacillus subtilis
PDB Compounds: (E:) Histidine triad protein

SCOPe Domain Sequences for d1y23e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y23e_ d.13.1.1 (E:) Hit {Bacillus subtilis [TaxId: 1423]}
encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
dykpedlqnisssiakrlass

SCOPe Domain Coordinates for d1y23e_:

Click to download the PDB-style file with coordinates for d1y23e_.
(The format of our PDB-style files is described here.)

Timeline for d1y23e_: