PDB entry 1y23

View 1y23 on RCSB PDB site
Description: Crystal structure of a member of HIT family of proteins from bacillus subtilis
Class: cell cycle
Keywords: HIT protein; PKCI-1; cell-cycle regulation; histidine triad; NYSGXRC; Structural Genomics; Protein Structure Initiative; T2097; New York SGX Research Center for Structural Genomics; PSI, CELL CYCLE
Deposited on 2004-11-19, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaE, HIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y23a_
  • Chain 'B':
    Compound: Histidine triad protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaE, HIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y23b_
  • Chain 'C':
    Compound: Histidine triad protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaE, HIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y23c_
  • Chain 'D':
    Compound: Histidine triad protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaE, HIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y23d_
  • Chain 'E':
    Compound: Histidine triad protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhaE, HIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y23e_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y23A (A:)
    mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdel
    akqyfhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwk
    thaddykpedlqnisssiakrlass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y23A (A:)
    encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
    fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
    dykpedlqnisssiakrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y23B (B:)
    mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdel
    akqyfhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwk
    thaddykpedlqnisssiakrlass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y23B (B:)
    encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
    fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
    dykpedlqnisssiakrlass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y23C (C:)
    mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdel
    akqyfhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwk
    thaddykpedlqnisssiakrlass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y23C (C:)
    encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
    fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
    dykpedlqnisssiakrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y23D (D:)
    mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdel
    akqyfhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwk
    thaddykpedlqnisssiakrlass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y23D (D:)
    encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
    fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
    dykpedlqnisssiakrla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y23E (E:)
    mhcaencifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdel
    akqyfhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwk
    thaddykpedlqnisssiakrlass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y23E (E:)
    encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy
    fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad
    dykpedlqnisssiakrlass