| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
| Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries) Uniprot P34087 |
| Domain d1y14d1: 1y14 D:81-171 [116326] Other proteins in same PDB: d1y14a_, d1y14b2, d1y14c_, d1y14d2 |
PDB Entry: 1y14 (more details), 2.3 Å
SCOPe Domain Sequences for d1y14d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y14d1 b.40.4.5 (D:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai
Timeline for d1y14d1:
View in 3DDomains from other chains: (mouse over for more information) d1y14a_, d1y14b1, d1y14b2, d1y14c_ |