Lineage for d1y14d1 (1y14 D:81-171)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668328Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
  7. 668332Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
  8. 668334Domain d1y14d1: 1y14 D:81-171 [116326]
    Other proteins in same PDB: d1y14a_, d1y14b2, d1y14c_, d1y14d2

Details for d1y14d1

PDB Entry: 1y14 (more details), 2.3 Å

PDB Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7
PDB Compounds: (D:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOP Domain Sequences for d1y14d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y14d1 b.40.4.5 (D:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

SCOP Domain Coordinates for d1y14d1:

Click to download the PDB-style file with coordinates for d1y14d1.
(The format of our PDB-style files is described here.)

Timeline for d1y14d1: