SCOP 1.75: Domain d1y14b1: 1y14 B:81-171

Lineage for d1y14b1 (1y14 B:81-171)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
   Uniprot P34087

8. Domain d1y14b1: 1y14 B:81-171 [116323]
   Other proteins in same PDB: d1y14a_, d1y14b2, d1y14c_, d1y14d2

Details for d1y14b1

PDB Entry: 1y14, 2.3 Å

PDB Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7

PDB Compounds: (B:) DNA-directed RNA polymerase II 19 kDa polypeptide

SCOP Domain Sequences for d1y14b1:

Sequence, based on SEQRES records:

>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

Sequence, based on observed residues (ATOM records):

>d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnasyqssedvitiksrirv
kiegcisqvssihaigsikedylgai

Timeline for d1y14b1:

• d1y14b1 first appeared in SCOP 1.71
  
• d1y14b1 appears in SCOP 1.73
  
• d1y14b1 appears in SCOPe 2.01
  
• d1y14b1 appears in the current release, SCOPe 2.08