Lineage for d1y0gd_ (1y0g D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416119Superfamily b.61.6: YceI-like [101874] (2 families) (S)
  5. 2416120Family b.61.6.1: YceI-like [101875] (2 proteins)
    Pfam PF04264
  6. 2416121Protein Lipid binding protein YceI [117267] (1 species)
  7. 2416122Species Escherichia coli [TaxId:562] [117268] (1 PDB entry)
    Uniprot P0A8X2
  8. 2416126Domain d1y0gd_: 1y0g D: [116302]
    Structural genomics target
    complexed with 8pp

Details for d1y0gd_

PDB Entry: 1y0g (more details), 2.2 Å

PDB Description: crystal structure of the escherichia coli ycei protein, structural genomics
PDB Compounds: (D:) Protein yceI

SCOPe Domain Sequences for d1y0gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0gd_ b.61.6.1 (D:) Lipid binding protein YceI {Escherichia coli [TaxId: 562]}
adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk

SCOPe Domain Coordinates for d1y0gd_:

Click to download the PDB-style file with coordinates for d1y0gd_.
(The format of our PDB-style files is described here.)

Timeline for d1y0gd_: