Lineage for d1xyua_ (1xyu A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400466Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1400467Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1400468Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1400469Protein Prion protein domain [54100] (13 species)
  7. 1400517Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 1400519Domain d1xyua_: 1xyu A: [116232]

Details for d1xyua_

PDB Entry: 1xyu (more details)

PDB Description: solution structure of the sheep prion protein with polymorphism h168
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1xyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyua_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdhysnqnnfvhdcv
nitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas

SCOPe Domain Coordinates for d1xyua_:

Click to download the PDB-style file with coordinates for d1xyua_.
(The format of our PDB-style files is described here.)

Timeline for d1xyua_: