![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein Prion protein domain [54100] (14 species) |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries) Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228 |
![]() | Domain d1xyua_: 1xyu A: [116232] |
PDB Entry: 1xyu (more details)
SCOPe Domain Sequences for d1xyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyua_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]} vvgglggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdhysnqnnfvhdcv nitvkqhtvttttkgenftetdikimervveqmcitqyqresqayyqrgas
Timeline for d1xyua_: