Lineage for d1xyqa_ (1xyq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890620Protein Prion protein domain [54100] (14 species)
  7. 1890664Species Pig (Sus scrofa) [TaxId:9823] [117771] (1 PDB entry)
    Uniprot P49927 125-235
  8. 1890665Domain d1xyqa_: 1xyq A: [116231]

Details for d1xyqa_

PDB Entry: 1xyq (more details)

PDB Description: nmr structure of the pig prion protein
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1xyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyqa_ d.6.1.1 (A:) Prion protein domain {Pig (Sus scrofa) [TaxId: 9823]}
vvgglggymlgsamsrplihfgsdyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcv
nitvkqhtvttttkgenftetdvkmiervveqmcitqyqkeyeayaqrgas

SCOPe Domain Coordinates for d1xyqa_:

Click to download the PDB-style file with coordinates for d1xyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1xyqa_: