Lineage for d1xyqa_ (1xyq A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597694Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 597695Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 597696Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 597697Protein Prion protein domain [54100] (12 species)
  7. 597738Species Pig (Sus scrofa) [TaxId:9823] [117771] (1 PDB entry)
  8. 597739Domain d1xyqa_: 1xyq A: [116231]

Details for d1xyqa_

PDB Entry: 1xyq (more details)

PDB Description: nmr structure of the pig prion protein

SCOP Domain Sequences for d1xyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyqa_ d.6.1.1 (A:) Prion protein domain {Pig (Sus scrofa)}
vvgglggymlgsamsrplihfgsdyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcv
nitvkqhtvttttkgenftetdvkmiervveqmcitqyqkeyeayaqrgas

SCOP Domain Coordinates for d1xyqa_:

Click to download the PDB-style file with coordinates for d1xyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1xyqa_: