Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117428] (2 PDB entries) Uniprot O82187 15-359 |
Domain d1xygc1: 1xyg C:15-162,C:327-359 [116225] Other proteins in same PDB: d1xyga2, d1xygb2, d1xygc2, d1xygd2 |
PDB Entry: 1xyg (more details), 2.19 Å
SCOPe Domain Sequences for d1xygc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xygc1 c.2.1.3 (C:15-162,C:327-359) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav elqkevvyglteilredikkarlvanpgXnlvkgasgqalqnlnimlgypettgllhqpl fp
Timeline for d1xygc1: