Lineage for d1xxhf1 (1xxh F:212-338)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772824Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 772825Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 772826Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 772835Protein delta subunit [63580] (1 species)
  7. 772836Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
    Uniprot P28630
  8. 772841Domain d1xxhf1: 1xxh F:212-338 [116173]
    Other proteins in same PDB: d1xxha2, d1xxhb1, d1xxhb2, d1xxhc1, d1xxhc2, d1xxhd1, d1xxhd2, d1xxhe1, d1xxhe2, d1xxhf2, d1xxhg1, d1xxhg2, d1xxhh1, d1xxhh2, d1xxhi1, d1xxhi2, d1xxhj1, d1xxhj2
    complexed with atg, po4, zn

Details for d1xxhf1

PDB Entry: 1xxh (more details), 3.45 Å

PDB Description: ATPgS Bound E. Coli Clamp Loader Complex
PDB Compounds: (F:) DNA Polymerase III, DELTA SUBUNIT

SCOP Domain Sequences for d1xxhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxhf1 a.80.1.1 (F:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

SCOP Domain Coordinates for d1xxhf1:

Click to download the PDB-style file with coordinates for d1xxhf1.
(The format of our PDB-style files is described here.)

Timeline for d1xxhf1: