Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Coagulation factor XI [117237] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117238] (4 PDB entries) Uniprot P03951 388-624 |
Domain d1xx9a_: 1xx9 A: [116149] Other proteins in same PDB: d1xx9c_, d1xx9d_ |
PDB Entry: 1xx9 (more details), 2.2 Å
SCOP Domain Sequences for d1xx9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa
Timeline for d1xx9a_: