Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Ferric-binding protein FbpA [53867] (7 species) |
Species Serratia marcescens, SfuA [TaxId:615] [117743] (1 PDB entry) Uniprot P21408 32-338 |
Domain d1xvya_: 1xvy A: [116098] complexed with cit has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xvy (more details), 1.74 Å
SCOPe Domain Sequences for d1xvya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvya_ c.94.1.1 (A:) Ferric-binding protein FbpA {Serratia marcescens, SfuA [TaxId: 615]} giviynaqhenlvkswvdgftkdtgikvtlrnggdselgnqlvqegsaspadvfltensp amvlvdnaklfapldaatlaqvepqyrpshgrwigiaarstvfvynpaklsdaqlpksll dlakpewkgrwaaspsgadfqaivsallelkgekatlawlkamktnftaykgnstvmkav nagqvdsgviyhyypfvdgaktgensnniklyyfkhqdpgafvsisgggvlasskhqqqa qafikwitgkqgqeilrtnnafeyavgvgaasnpklvplkdldapkvdaaqlnskkvvel mteagll
Timeline for d1xvya_: