SCOP 1.75: Domain d1xvia_: 1xvi A:

Lineage for d1xvia_ (1xvi A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)

7. Species Escherichia coli [TaxId:562] [117506] (1 PDB entry)
   Uniprot P76329 4-235

8. Domain d1xvia_: 1xvi A: [116088]
   Structural genomics target

Details for d1xvia_

PDB Entry: 1xvi, 2.26 Å

PDB Description: Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12

PDB Compounds: (A:) Putative mannosyl-3-phosphoglycerate phosphatase

SCOP Domain Sequences for d1xvia_:

Sequence; same for both SEQRES and ATOM records:

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}
iqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqktlgl
qglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfddvdd
atiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwhvld
asagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgln

Timeline for d1xvia_:

• d1xvia_ first appeared in SCOP 1.71
  
• d1xvia_ appears in SCOP 1.73
  
• d1xvia_ appears in SCOPe 2.01
  
• d1xvia_ appears in the current release, SCOPe 2.08