Lineage for d1xvib_ (1xvi B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848143Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 848179Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)
  7. 848183Species Escherichia coli [TaxId:562] [117506] (1 PDB entry)
    Uniprot P76329 4-235
  8. 848185Domain d1xvib_: 1xvi B: [116089]
    Structural genomics target
    complexed with 1pe, pg4, pge, so4

Details for d1xvib_

PDB Entry: 1xvi (more details), 2.26 Å

PDB Description: Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12
PDB Compounds: (B:) Putative mannosyl-3-phosphoglycerate phosphatase

SCOP Domain Sequences for d1xvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvib_ c.108.1.10 (B:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}
mfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqkt
lglqglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfdd
vddatiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwh
vldasagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgl

SCOP Domain Coordinates for d1xvib_:

Click to download the PDB-style file with coordinates for d1xvib_.
(The format of our PDB-style files is described here.)

Timeline for d1xvib_: