Lineage for d1xuza1 (1xuz A:282-349)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817865Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2817866Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 2817867Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species)
  7. Species Neisseria meningitidis [TaxId:487] [117331] (2 PDB entries)
    Uniprot Q57265
  8. 2817870Domain d1xuza1: 1xuz A:282-349 [116072]
    Other proteins in same PDB: d1xuza2
    complexed with mmn, mn, pep

Details for d1xuza1

PDB Entry: 1xuz (more details), 2.2 Å

PDB Description: Crystal structure analysis of sialic acid synthase (NeuB)from Neisseria meningitidis, bound to Mn2+, Phosphoenolpyruvate, and N-acetyl mannosaminitol
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d1xuza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuza1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d1xuza1:

Click to download the PDB-style file with coordinates for d1xuza1.
(The format of our PDB-style files is described here.)

Timeline for d1xuza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuza2