![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.1: AFP III-like domain [51269] (2 families) ![]() duplication: consists of two structural repeats related by pseudo dyad |
![]() | Family b.85.1.1: AFP III-like domain [51270] (4 proteins) Pfam PF01354 |
![]() | Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species) |
![]() | Domain d1xuza1: 1xuz A:282-349 [116072] Other proteins in same PDB: d1xuza2 complexed with mmn, mn, pep |
PDB Entry: 1xuz (more details), 2.2 Å
SCOPe Domain Sequences for d1xuza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuza1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]} ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga qikktdie
Timeline for d1xuza1: