Lineage for d1xuza2 (1xuz A:2-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835884Family c.1.10.6: NeuB-like [110368] (3 proteins)
    Pfam PF03102
  6. 2835885Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species)
  7. Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries)
    Uniprot Q57265
  8. 2835888Domain d1xuza2: 1xuz A:2-281 [116073]
    Other proteins in same PDB: d1xuza1
    complexed with mmn, mn, pep

Details for d1xuza2

PDB Entry: 1xuz (more details), 2.2 Å

PDB Description: Crystal structure analysis of sialic acid synthase (NeuB)from Neisseria meningitidis, bound to Mn2+, Phosphoenolpyruvate, and N-acetyl mannosaminitol
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d1xuza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuza2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d1xuza2:

Click to download the PDB-style file with coordinates for d1xuza2.
(The format of our PDB-style files is described here.)

Timeline for d1xuza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuza1