SCOPe 2.08: Domain d1xuza2: 1xuz A:2-281

Lineage for d1xuza2 (1xuz A:2-281)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.6: NeuB-like [110368] (3 proteins)
   Pfam PF03102

6. Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species)

7. Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries)
   Uniprot Q57265

8. Domain d1xuza2: 1xuz A:2-281 [116073]
   Other proteins in same PDB: d1xuza1
   complexed with mmn, mn, pep

Details for d1xuza2

PDB Entry: 1xuz, 2.2 Å

PDB Description: Crystal structure analysis of sialic acid synthase (NeuB)from Neisseria meningitidis, bound to Mn2+, Phosphoenolpyruvate, and N-acetyl mannosaminitol

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d1xuza2:

Sequence; same for both SEQRES and ATOM records:

>d1xuza2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

Timeline for d1xuza2:

• d1xuza2 first appeared in SCOP 1.71
  
• d1xuza2 appears in SCOPe 2.07