Lineage for d1xupo2 (1xup O:257-491)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372952Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1372953Protein Glycerol kinase [53090] (2 species)
  7. 1372954Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 1372992Domain d1xupo2: 1xup O:257-491 [116063]
    complexed with gol

Details for d1xupo2

PDB Entry: 1xup (more details), 2.75 Å

PDB Description: enterococcus casseliflavus glycerol kinase complexed with glycerol
PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d1xupo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xupo2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
fekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsaiqw
lrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttked
fvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqraan
lettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqav

SCOPe Domain Coordinates for d1xupo2:

Click to download the PDB-style file with coordinates for d1xupo2.
(The format of our PDB-style files is described here.)

Timeline for d1xupo2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xupo1