![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
![]() | Protein Glycerol kinase [53090] (2 species) |
![]() | Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries) Uniprot O34153 5-491 |
![]() | Domain d1xupo1: 1xup O:6-256 [116062] complexed with gol |
PDB Entry: 1xup (more details), 2.75 Å
SCOPe Domain Sequences for d1xupo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xupo1 c.55.1.4 (O:6-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag dqqaalfgqma
Timeline for d1xupo1: