SCOPe 2.07: Domain d1xu1t_: 1xu1 T:

Lineage for d1xu1t_ (1xu1 T:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
   only fragments of the receptor structures are available; no domain division is provided here

6. Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
   Uniprot O14836 68-109

8. Domain d1xu1t_: 1xu1 T: [116038]
   Other proteins in same PDB: d1xu1a_, d1xu1b_, d1xu1d_
   complexed with ni

Details for d1xu1t_

PDB Entry: 1xu1, 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI

PDB Compounds: (T:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xu1t_:

Sequence; same for both SEQRES and ATOM records:

>d1xu1t_ g.24.1.2 (T:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
crkeqgkfydhllrdciscasicgqhpkqcayfcenklr

Timeline for d1xu1t_:

• d1xu1t_ first appeared in SCOP 1.71
  
• d1xu1t_ appears in SCOPe 2.06
  
• d1xu1t_ appears in the current release, SCOPe 2.08