SCOPe 2.08: Domain d1xt3b_: 1xt3 B:

Lineage for d1xt3b_ (1xt3 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Cardiotoxin III [57337] (1 species)

7. Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57338] (6 PDB entries)
   Uniprot P60301 22-81

8. Domain d1xt3b_: 1xt3 B: [116011]
   complexed with cit

Details for d1xt3b_

PDB Entry: 1xt3, 2.4 Å

PDB Description: structure basis of venom citrate-dependent heparin sulfate-mediated cell surface retention of cobra cardiotoxin a3

PDB Compounds: (B:) cytotoxin 3

SCOPe Domain Sequences for d1xt3b_:

Sequence; same for both SEQRES and ATOM records:

>d1xt3b_ g.7.1.1 (B:) Cardiotoxin III {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn

Timeline for d1xt3b_:

• d1xt3b_ first appeared in SCOP 1.71
  
• d1xt3b_ appears in SCOPe 2.07