Lineage for d1xsjb3 (1xsj B:586-665)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556187Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 1556188Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 1556189Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 1556197Domain d1xsjb3: 1xsj B:586-665 [115957]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjd1, d1xsjd2, d1xsjd4, d1xsje1, d1xsje2, d1xsje4, d1xsjf1, d1xsjf2, d1xsjf4
    complexed with trs

Details for d1xsjb3

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsjb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjb3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d1xsjb3:

Click to download the PDB-style file with coordinates for d1xsjb3.
(The format of our PDB-style files is described here.)

Timeline for d1xsjb3: