Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins) |
Protein Putative phosphatase At1g05000 [117579] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries) Uniprot Q9ZVN4 52-201 |
Domain d1xrib_: 1xri B: [115880] complexed with so4 |
PDB Entry: 1xri (more details), 3.3 Å
SCOP Domain Sequences for d1xrib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrib_ c.45.1.1 (B:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc ltsifdeyqrfaaakarvsdqrfmeifdvss
Timeline for d1xrib_: