Lineage for d1xrib_ (1xri B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833132Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 833133Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 833134Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)
  6. 833172Protein Putative phosphatase At1g05000 [117579] (1 species)
  7. 833173Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries)
    Uniprot Q9ZVN4 52-201
  8. 833175Domain d1xrib_: 1xri B: [115880]
    complexed with so4

Details for d1xrib_

PDB Entry: 1xri (more details), 3.3 Å

PDB Description: x-ray structure of a putative phosphoprotein phosphatase from arabidopsis thaliana gene at1g05000
PDB Compounds: (B:) At1g05000

SCOP Domain Sequences for d1xrib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrib_ c.45.1.1 (B:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
ltsifdeyqrfaaakarvsdqrfmeifdvss

SCOP Domain Coordinates for d1xrib_:

Click to download the PDB-style file with coordinates for d1xrib_.
(The format of our PDB-style files is described here.)

Timeline for d1xrib_: