SCOPe 2.08: Domain d1xria_: 1xri A:

Lineage for d1xria_ (1xri A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Putative phosphatase At1g05000 [117579] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117580] (2 PDB entries)
   Uniprot Q9ZVN4 52-201

8. Domain d1xria_: 1xri A: [115879]
   complexed with so4

Details for d1xria_

PDB Entry: 1xri, 3.3 Å

PDB Description: x-ray structure of a putative phosphoprotein phosphatase from arabidopsis thaliana gene at1g05000

PDB Compounds: (A:) At1g05000

SCOPe Domain Sequences for d1xria_:

Sequence; same for both SEQRES and ATOM records:

>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
ltsifdeyqrfaaakarvsdqrfmeifdvss

Timeline for d1xria_:

• d1xria_ first appeared in SCOP 1.71
  
• d1xria_ appears in SCOPe 2.07