Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Purine regulatory protein YabJ [55302] (2 species) |
Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry) |
Domain d1xrga_: 1xrg A: [115868] |
PDB Entry: 1xrg (more details), 2.2 Å
SCOP Domain Sequences for d1xrga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} yievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlkn vleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieie avaik
Timeline for d1xrga_: