Lineage for d1xrga_ (1xrg A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606052Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 606053Family d.79.1.1: YjgF/L-PSP [55299] (5 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 606095Protein Purine regulatory protein YabJ [55302] (2 species)
  7. 606100Species Clostridium thermocellum [TaxId:1515] [118024] (1 PDB entry)
  8. 606101Domain d1xrga_: 1xrg A: [115868]

Details for d1xrga_

PDB Entry: 1xrg (more details), 2.2 Å

PDB Description: conserved hypothetical protein from clostridium thermocellum cth-2968

SCOP Domain Sequences for d1xrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum}
yievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlkn
vleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieie
avaik

SCOP Domain Coordinates for d1xrga_:

Click to download the PDB-style file with coordinates for d1xrga_.
(The format of our PDB-style files is described here.)

Timeline for d1xrga_: